PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000792088
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 227aa    MW: 25551 Da    PI: 10.1491
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000792088genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY35.42.2e-11111137127
                    ---SS-EEEEEEE--TT-SS-EEEEEE CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrC 27 
                    ldDgy+WrKYGqK vk+++fp     C
  MDP0000792088 111 LDDGYRWRKYGQKAVKNNKFPSVISSC 137
                    59******************9765555 PP

2WRKY52.78.5e-171672052159
                    -EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY  21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    + sYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+
  MDP0000792088 167 ALSYYRCTHHGCNVKKQVQRLTKDEGVVVTTYEGMHSHP 205
                    679***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.4E-3196131IPR003657WRKY domain
SuperFamilySSF1182907.59E-10103141IPR003657WRKY domain
PROSITE profilePS5081123.227106207IPR003657WRKY domain
SMARTSM007742.5E-30111206IPR003657WRKY domain
PfamPF031069.2E-8112139IPR003657WRKY domain
PfamPF031062.3E-12167205IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.4E-31168205IPR003657WRKY domain
SuperFamilySSF1182901.57E-13169206IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MENYPTFFSS STAPAPSPLS LNMGNPAHHV YNSNDPRQFQ NRKSSNGFLG LMSEMEASNN  60
MIKNNFSSQG KSFGGSESGE ATVRLGMKKG DQKKIRKPRY AFQTRSQVDI LDDGYRWRKY  120
GQKAVKNNKF PSVISSCITR SASAVSLFFV LQLLLLRMNL TLEKDGALSY YRCTHHGCNV  180
KKQVQRLTKD EGVVVTTYEG MHSHPIEKST DNFEHILSQM KIYTPF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.302521e-176root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF8879821e-168KF887982.1 Malus baccata WRKY75 (WRKY75) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008389898.11e-136PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA27e-50WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLW8E2P51e-110W8E2P5_MALBA; WRKY75
STRINGPOPTR_0003s16750.12e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.19e-51WRKY DNA-binding protein 75